PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr031409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 335aa    MW: 37049.6 Da    PI: 7.6056
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr031409.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed +l d++++ G g+W++ ++  g++R++k+c++rw +yl
      Pbr031409.1 15 KGPWTMDEDAKLTDYIRRNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding55.31.5e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+  +++++  lG++ W++Ia +++ gRt++++k++w+++l
      Pbr031409.1  68 RGKFSEEEERVIINLHSVLGNR-WSKIATHLP-GRTDNEIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-22765IPR009057Homeodomain-like
PROSITE profilePS5129414.8371062IPR017930Myb domain
SuperFamilySSF466896.5E-3012109IPR009057Homeodomain-like
SMARTSM007174.7E-111464IPR001005SANT/Myb domain
PfamPF002496.5E-141562IPR001005SANT/Myb domain
CDDcd001675.91E-81762No hitNo description
PROSITE profilePS5129428.89963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2766117IPR009057Homeodomain-like
SMARTSM007173.5E-1767115IPR001005SANT/Myb domain
PfamPF002495.5E-1668113IPR001005SANT/Myb domain
CDDcd001677.12E-1370113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVRSPCCDEE NSLKKGPWTM DEDAKLTDYI RRNGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEEEERVII NLHSVLGNRW SKIATHLPGR TDNEIKNYWN THLRKKLLHM  120
GIDPNTHKPR TDLNHLLDLS WLLRAASVGN SNMMTSPWDN AMSLQAAAGA AQLAKMQLLQ  180
CLYMMPVVST SNGSVPPKNY NADVMNTTTS SHFGSHSLHL FGGGNMSGAS TILSGQKWNQ  240
QADKVDGFHA ISNLFEGFQG GFGAQGGINS NSTDQENMTS SCYGDIYVQT SNQPPPAFSS  300
AALSPGTSST AIFDAWEKLM DDETSESYWK DILE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30131175108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340212.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM5WRB41e-118M5WRB4_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s09300.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.28e-78myb domain protein 9